CoraLite® Plus 488-conjugated CROP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated CROP Recombinant monoclonal antibody (CL488-86690)

• 

  IF Staining of HepG2 using CL488-86690

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 CROP antibody (CL488-86690, Clone: 251672C12 ) at dilution of 1:200, CL594-phalloidin (red).

CROP Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86690

Clone No.251672C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

cAMP regulatory element-associated protein 1, Cisplatin resistance-associated-overexpressed protein, CRE associated protein 1, CREAP 1, CREAP1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86690 targets CROP in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5961

  Product name: Recombinant human CROP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC056409

  Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE

• Full Name: cisplatin resistance-associated overexpressed protein
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC056409
• Gene Symbol: CROP
• Gene ID (NCBI): 51747
• RRID: AB_3747855
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95232
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP.