Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated CROP Recombinant monoclonal antibody

CROP Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-86690
Clone No.251672C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

cAMP regulatory element-associated protein 1, Cisplatin resistance-associated-overexpressed protein, CRE associated protein 1, CREAP 1, CREAP1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86690 targets CROP in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5961

Product name: Recombinant human CROP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-79 aa of BC056409

Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE

Predict reactive species
Full Name cisplatin resistance-associated overexpressed protein
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 55-58 kDa
GenBank Accession NumberBC056409
Gene Symbol CROP
Gene ID (NCBI) 51747
RRIDAB_3747855
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95232
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CROP antibody CL488-86690Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...