FITC Plus Anti-Human CRTAM/CD355 Rabbit Recombinant Antibody

CRTAM/CD355 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98157
Clone No.241280B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CRTAM, 241280B12, CD355, Class-I MHC-restricted T-cell-associated molecule, Cytotoxic and regulatory T-cell molecule

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPMA and ionomycin treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98157 targets CRTAM/CD355 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1541

Product name: Recombinant Human CRTAM protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 18-286 aa of NM_019604.4

Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

Predict reactive species
Full Name cytotoxic and regulatory T cell molecule
Calculated Molecular Weight45 kDa
GenBank Accession NumberNM_019604.4
Gene Symbol CRTAM
Gene ID (NCBI) 56253
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95727-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Cytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223).

Loading...
||
New chat Able
正在加载,请稍候...