CRYBA4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CRYBA4 Polyclonal antibody (33621-1-AP)

• 

  WB analysis using 33621-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33621-1-AP (CRYBA4 antibody) at dilution of 1:80000 incubated at room temperature for 1.5 hours.

CRYBA4 Polyclonal Antibody for WB, ELISA

Cat No. 33621-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Beta A4 crystallin, Beta crystallin A4, crystallin, beta A4

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33621-1-AP targets CRYBA4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39089

  Product name: Recombinant human CRYBA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC069404

  Sequence: MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWV

• Full Name: crystallin, beta A4
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC069404
• Gene Symbol: CRYBA4
• Gene ID (NCBI): 1413
• RRID: AB_3743031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P53673
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRYBA4, also called βA4-crystallin, is the dominant structural components of the vertebrate eye lens (PMID: 16960806). Missense mutations of CRYBA4 (e.g., p.R95W, p.V150D) predicted to be highly pathogenic are linked with autosomal-dominant congenital cataract, indicating that both crystallin aggregation and non-lens signaling functions merit therapeutic targeting (PMID: 31935276).