CRYBB1 Monoclonal antibody, PBS Only

• 

  WB analysis of C6 using 60273-1-Ig (same clone as 60273-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 60273-1-Ig (CRYBB1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit eye using 60273-1-Ig (same clone as 60273-1-PBS)

  rabbit eye tissue were subjected to SDS PAGE followed by western blot with 60273-1-Ig (CRYBB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat eye using 60273-1-Ig (same clone as 60273-1-PBS)

  rat eye tissue were subjected to SDS PAGE followed by western blot with 60273-1-Ig (CRYBB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse eye using 60273-1-Ig (same clone as 60273-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 60273-1-Ig (CRYBB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60273-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 60273-1-Ig (same clone as 60273-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CRYBB1 antibody (60273-1-Ig, Clone: 6F12B12 ) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60273-1-PBS in a different storage buffer formulation.

CRYBB1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 60273-1-PBS

Clone No.6F12B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

6F12B12, Beta B1 crystallin, Beta crystallin B1, Beta-B1 crystallin, Beta-crystallin B1

---

Product Information

60273-1-PBS targets CRYBB1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4722

  Product name: Recombinant human CRYBB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-252 aa of BC036790

  Sequence: MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK

• Full Name: crystallin, beta B1
• Calculated Molecular Weight: 252 aa, 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC036790
• Gene Symbol: CRYBB1
• Gene ID (NCBI): 1414
• RRID: AB_2881393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P53674
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mutation in CRYBB1 is associated with congenital Cataract-Microcornea Syndrome.