CRYBB2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68481-1-Ig (same clone as 68481-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68481-1-Ig (CRYBB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68481-1-PBS in a different storage buffer formulation.

CRYBB2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68481-1-PBS

Clone No.2E5E7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

2E5E7, Beta-B2 crystallin, Beta-crystallin B2, Beta-crystallin Bp, CCA2

---

Product Information

68481-1-PBS targets CRYBB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12916

  Product name: Recombinant human CRYBB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-205 aa of BC069535

  Sequence: MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN

• Full Name: crystallin, beta B2
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC069535
• Gene Symbol: CRYBB2
• Gene ID (NCBI): 1415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P43320
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.