CoraLite® Plus 488-conjugated CSDC2 Recombinant monoclonal antibody

CSDC2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83886-6
Clone No.241031A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

RNA-binding protein PIPPin, RNA binding protein PIPPin, PIPPIN, Cold shock domain-containing protein C2, 241031A11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83886-6 targets CSDC2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16216

Product name: Recombinant human CSDC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC067113

Sequence: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG

Predict reactive species
Full Name cold shock domain containing C2, RNA binding
Calculated Molecular Weight 153 aa, 17 kDa
GenBank Accession NumberBC067113
Gene Symbol CSDC2
Gene ID (NCBI) 27254
RRIDAB_3673322
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y534
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PIPPIN, also known as CSDC2 (Cold shock domain-containing protein C2) is an RNA‐binding protein (RBP), highly enriched in the rat brain, specifically enriched in some pyramidal neurons of the cerebral cortex and in the Purkinje cells of the cerebellum (PMID: 10446180). PIPPIN has the potential to undergo different posttranslational modifications and might be a good candidate to regulate the synthesis of specific proteins in response to extracellular stimuli. Nuclear CSDC2 is connected to proliferation and cytoplasmic CSDC2 to terminal differentiation in the decidua and that CSDC2 could regulate differentiation during decidua development (PMID: 30078185, PMID: 17053029).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CSDC2 antibody CL488-83886-6Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...