CSF2RA/CD116 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CSF2RA/CD116 Polyclonal antibody (32058-1-AP)

• 

  WB analysis using 32058-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32058-1-AP (CSF2RA/CD116 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 32058-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32058-1-AP (CSF2RA/CD116 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 32058-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32058-1-AP (CSF2RA/CD116 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CSF2RA/CD116 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32058-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD116, Csf2ra, Csfgmra, GM-CSF-R-alpha, GMCSFR-alpha

---

Tested Applications

• Positive WB detected in: J774A.1 cells, RAW 264.7 cells, rat lung tissue
• Positive IHC detected in: mouse lung tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32058-1-AP targets CSF2RA/CD116 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2016

  Product name: Recombinant Mouse CSF2RA/CD116 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-327 aa of NM_009970.2

  Sequence: LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVP

• Full Name: colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
• Calculated Molecular Weight: 42kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_009970.2
• Gene Symbol: CSF2RA/CD116
• Gene ID (NCBI): 12982
• RRID: AB_3742519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q00941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD116, also named as CSF2RA CDw116 CSF2RAX CSF2RAY CSF2RX CSF2RY GM-CSF-R-alpha GMCSFR and GMR, is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CD116 transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.