Anti-Mouse CSF2RA/CD116 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98196-1-RR (same clone as 98196-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CSF2RA/CD116 Rabbit Recombinant Antibody (98196-1-RR, Clone: 241889A5) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Mouse CD11b. Cells were not fixed. This data was developed using the same antibody clone with 98196-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98196-1-RR (same clone as 98196-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CSF2RA/CD116 Rabbit Recombinant Antibody (98196-1-RR, Clone: 241889A5) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98196-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98196-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98196-1-RR against Mouse CSF2RA/CD116 were performed. The affinity constant is below 1 pM.

CSF2RA/CD116 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98196-1-PBS

Clone No.241889A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241889A5, CD116, Csf2ra, Csfgmra, GM-CSF-R-alpha

---

Product Information

98196-1-PBS targets CSF2RA/CD116 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2016

  Product name: Recombinant Mouse CSF2RA/CD116 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-327 aa of NM_009970.2

  Sequence: LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVP

• Full Name: colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
• Calculated Molecular Weight: 42kDa
• GenBank Accession Number: NM_009970.2
• Gene Symbol: CSF2RA/CD116
• Gene ID (NCBI): 12982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q00941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD116, also named as CSF2RA CDw116 CSF2RAX CSF2RAY CSF2RX CSF2RY GM-CSF-R-alpha GMCSFR and GMR, is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CD116 transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.