Anti-Mouse IL-3RB/CD131 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98232-1-RR (same clone as 98232-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse IL-3RB/CD131 Rabbit RecAb (98232-1-RR, Clone: 241954C1) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Mouse CD11b (M1/70) (APC-65055, Clone: M1/70). Cells were not fixed. This data was developed using the same antibody clone with 98232-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98232-1-RR (same clone as 98232-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse IL-3RB/CD131 Rabbit RecAb (98232-1-RR, Clone: 241954C1) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98232-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98232-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98232-1-RR against Mouse IL-3RB/CD131 were performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 98232-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98232-1-RR against Mouse IL-3RB/CD131 were performed. The affinity constant is below 1 pM.

IL-3RB/CD131 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98232-1-PBS

Clone No.241954C1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241954C1, Aic2b, CD131, Csf2rb, Csf2rb1

---

Product Information

98232-1-PBS targets IL-3RB/CD131 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2173

  Product name: Recombinant Mouse IL-3RB/CD131 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-441 aa of NM_007780.4

  Sequence: HGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDW

• Full Name: colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage)
• Calculated Molecular Weight: 99kDa
• GenBank Accession Number: NM_007780.4
• Gene Symbol: IL-3RB/CD131
• Gene ID (NCBI): 12983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P26955
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD131, also known as IL-3RB, IL-5RB, colony stimulating factor 2 receptor subunit beta (CSF2RB), or cytokine receptor common subunit beta, is the common subunit of the type I cytokine receptors for granulocyte-macrophage colony-stimulating factor (GM-CSF), IL-3 and IL-5 (PMID: 36532080). It is expressed predominantly by hematopoietic cells but also by non-hematopoietic cells (PMID: 10582335). CD131 mediates intracellular signaling by JAK2, leading to phosphorylation of CD131 and triggering signaling pathways such as STAT5, MAPK and PI3-Kinase/AKT which regulate cell survival, proliferation and function (PMID: 23535386).