CSGALNACT1 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 26913-1-AP (same clone as 26913-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26913-1-AP (CSGALNACT1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26913-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 26913-1-AP (same clone as 26913-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26913-1-AP (CSGALNACT1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26913-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 26913-1-AP (same clone as 26913-1-PBS)

  IP result of anti-CSGALNACT1 (IP:26913-1-AP, 4ug; Detection:26913-1-AP 1:1000) with PC-3 cells lysate 3200ug. This data was developed using the same antibody clone with 26913-1-PBS in a different storage buffer formulation.

CSGALNACT1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 26913-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

26913-1-PBS targets CSGALNACT1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25455

  Product name: Recombinant human CSGALNACT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 89-149 aa of BC060772

  Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD

• Full Name: chondroitin sulfate N-acetylgalactosaminyltransferase 1
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61-68 kDa
• GenBank Accession Number: BC060772
• Gene Symbol: CSGALNACT1
• Gene ID (NCBI): 55790
• RRID: AB_2880682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDX6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis.