Placental lactogen Recombinant monoclonal antibody, PBS Only (Capture/Detector)

Placental lactogen Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84361-2-PBS
Clone No.241625E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

CSH1, 241625E1, Choriomammotropin Alternative names Lactogen, Chorionic somatomammotropin hormone 2, CSH2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84361-2-PBS targets Placental lactogen as part of a matched antibody pair:

MP01252-1: 84361-2-PBS capture and 84361-1-PBS detection (validated in Cytometric bead array)

MP01252-2: 84361-4-PBS capture and 84361-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0201

Product name: Recombinant human CSH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-207 aa of BC002717

Sequence: RTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ

Predict reactive species
Full Name chorionic somatomammotropin hormone 1 (placental lactogen)
Calculated Molecular Weight 25 kDa
Observed Molecular Weight20-25 kDa
GenBank Accession NumberBC002717
Gene Symbol CSH1
Gene ID (NCBI) 1442
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP0DML2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Chorionic somatomammotropin hormone 1 (placental lactogen, CSH1), is a hormone with the molecular weight of 25 kDa. The data suggest that this protein may link with the Silver-Russell syndrome (SRS), a disease of pre- and postnatal growth restriction and a characteristic small, triangular face. SRS is also accompanied by other dysmorphic features including fifth finger clinodactyly and skeletal asymmetry.

Loading...
||
New chat Able
正在加载,请稍候...