CSNK2A2 Recombinant monoclonal antibody

• 

  WB analysis using 86169-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86169-2-RR (CSNK2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86169-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CSNK2A2 antibody (86169-2-RR, Clone: 250812B3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86169-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86169-2-RR against Human CSNK2A2 were performed. The affinity constant is below 1 pM.

CSNK2A2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86169-2-RR

Clone No.250812B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

CSNK2A 2, CSNK2A1, EC:2.7.11.1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, A-673 cells, Jurkat cells, NIH/3T3 cells, PC-12 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86169-2-RR targets CSNK2A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0877

  Product name: Recombinant human CSNK2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-350 aa of BC008812

  Sequence: KYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Full Name: casein kinase 2, alpha prime polypeptide
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC008812
• Gene Symbol: CSNK2A2
• Gene ID (NCBI): 1459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19784
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSNK2A2(Casein kinase II subunit alpha') is also named as CK2A3, CK2A2, CSNK2A1, CK2 and belongs to the protein kinase superfamily. It can function as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage during mitosis. It also can protect against ionizing radiation-induced apoptosis partly by phosphorylating and activating SIRT1.