Product Information
87698-1-PBS targets CST6 / Cystatin E/M in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg7630 Product name: Recombinant human CST6 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 29-149 aa of BC031334 Sequence: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM Predict reactive species |
| Full Name | cystatin E/M |
| Calculated Molecular Weight | 149 aa, 17 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC031334 |
| Gene Symbol | CST6 |
| Gene ID (NCBI) | 1474 |
| RRID | AB_3745704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15828 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cystatin E/M, also known as Cystatin 6 or Cystatin M, is a protein encoded by the CST6 gene in humans . It belongs to the type 2 cystatin family. The cystatin superfamily is a well-established group of cysteine protease inhibitors, which are proteins that block the activity of certain enzymes that break down other proteins . Within this superfamily, type 2 cystatins, including Cystatin E/M, are typically extracellular proteins found in various body fluids and secretions. One of the most critical roles of Cystatin E/M is in the formation and maintenance of the skin barrier. It regulates a specific proteolytic pathway essential for epidermal cornification (the formation of the outer skin layer) and hair follicle morphogenesis.
