CST6 / Cystatin E/M Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CST6 / Cystatin E/M Recombinant monoclonal antibody (87698-1-RR)

• 

  WB analysis of HCT 116 using 87698-1-RR

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 87698-1-RR (CST6 / Cystatin E/M antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CST6 / Cystatin E/M Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87698-1-RR

Clone No.253181F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CST6, Cystatin 6, Cystatin E, cystatin E/M, Cystatin M

---

Tested Applications

• Positive WB detected in: HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87698-1-RR targets CST6 / Cystatin E/M in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7630

  Product name: Recombinant human CST6 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 29-149 aa of BC031334

  Sequence: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

• Full Name: cystatin E/M
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC031334
• Gene Symbol: CST6
• Gene ID (NCBI): 1474
• RRID: AB_3745704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15828
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cystatin E/M, also known as Cystatin 6 or Cystatin M, is a protein encoded by the CST6 gene in humans . It belongs to the type 2 cystatin family. The cystatin superfamily is a well-established group of cysteine protease inhibitors, which are proteins that block the activity of certain enzymes that break down other proteins . Within this superfamily, type 2 cystatins, including Cystatin E/M, are typically extracellular proteins found in various body fluids and secretions. One of the most critical roles of Cystatin E/M is in the formation and maintenance of the skin barrier. It regulates a specific proteolytic pathway essential for epidermal cornification (the formation of the outer skin layer) and hair follicle morphogenesis.