Cystatin A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of U2OS using 84953-4-RR (same clone as 84953-4-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 84953-4-RR (CSTA antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84953-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84953-4-RR (same clone as 84953-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84953-4-RR (Cystatin A antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84953-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84953-4-RR (same clone as 84953-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84953-4-RR (Cystatin A antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84953-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84953-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84953-4-RR against Human Cystatin A were performed. The affinity constant is 0.286 nM.

Cystatin A Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84953-4-PBS

Clone No.242558F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CSTA, 242558F10, Cystatin AS, Cystatin-A, Cystatin-A, N-terminally processed

---

Product Information

84953-4-PBS targets Cystatin A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8733

  Product name: Recombinant human CSTA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC010379

  Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

• Full Name: cystatin A (stefin A)
• Calculated Molecular Weight: 98 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC010379
• Gene Symbol: Cystatin A
• Gene ID (NCBI): 1475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01040
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cystatin A (CSTA) is a member of the cystatin superfamily, which are thiol proteinase inhibitors (TPI) that play crucial roles in regulating proteolytic activity. It is a small protein composed of 98 amino acids with a molecular weight of approximately 11 kDa. CSTA is primarily expressed in epithelial tissues, such as the skin and esophagus, where it serves as a precursor protein for the cornified cell envelope in keratinocytes.