CSTF2T Polyclonal antibody

CSTF2T Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

TauCstF-64, TauCstF 64, KIAA0689, CstF 64T, Cleavage stimulation factor 64 kDa subunit tau variant

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat brain tissue, human brain tissue, HeLa cells, HepG2 cells, mouse liver tissue
Positive IP detected inmouse brain tissue, HeLa cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14206-1-AP targets CSTF2T in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5411

Product name: Recombinant human CSTF2T protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 277-616 aa of BC028239

Sequence: PGSLTPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMETRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASRQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS

Predict reactive species
Full Name cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC028239
Gene Symbol CSTF2T
Gene ID (NCBI) 23283
RRIDAB_2086478
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0L4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for CSTF2T antibody 14206-1-APDownload protocol
IHC protocol for CSTF2T antibody 14206-1-APDownload protocol
IP protocol for CSTF2T antibody 14206-1-APDownload protocol
WB protocol for CSTF2T antibody 14206-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...