CSTF2T Polyclonal antibody

• 

  WB analysis using 14206-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14206-1-AP (CSTF2T antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 14206-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14206-1-AP (CSTF2T Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14206-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14206-1-AP (CSTF2T antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14206-1-AP

  IP result of anti-CSTF2T (IP:14206-1-AP, 4ug; Detection:14206-1-AP 1:1000) with mouse brain tissue lysate 5200ug.

• 

  IP experiment of HeLa using 14206-1-AP

  IP result of anti-CSTF2T (IP:14206-1-AP, 4ug; Detection:14206-1-AP 1:300) with HeLa cells lysate 2000ug.

• 

  IP experiment of HeLa using 14206-1-AP

  IP result of anti-CSTF2T (IP:14206-1-AP, 4ug; Detection:14206-1-AP 1:300) with HeLa cells lysate 2000ug.

• 

  IHC staining of human prostate cancer using 14206-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 14206-1-AP (CSTF2T antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human prostate cancer using 14206-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 14206-1-AP (CSTF2T antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of HepG2 using 14206-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 14206-1-AP (CSTF2T antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CSTF2T Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TauCstF-64, TauCstF 64, KIAA0689, CstF 64T, Cleavage stimulation factor 64 kDa subunit tau variant

---

Tested Applications

• Positive WB detected in: A549 cells, rat brain tissue, human brain tissue, HeLa cells, HepG2 cells, mouse liver tissue
• Positive IP detected in: mouse brain tissue, HeLa cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14206-1-AP targets CSTF2T in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5411

  Product name: Recombinant human CSTF2T protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 277-616 aa of BC028239

  Sequence: PGSLTPGGAMQPQLGMPGVGPVPLERGQVQMSDPRAPIPRGPVTPGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHASGHDTRGPSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMETRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASRQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS

• Full Name: cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC028239
• Gene Symbol: CSTF2T
• Gene ID (NCBI): 23283
• RRID: AB_2086478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.