Tested Applications
| Positive WB detected in | A431 cells, K-562 cells, HEK-293 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24290-1-AP targets CSTF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17930 Product name: Recombinant human CSTF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC059948 Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN Predict reactive species |
| Full Name | cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
| Calculated Molecular Weight | 717 aa, 83 kDa |
| Observed Molecular Weight | 77-83 kDa |
| GenBank Accession Number | BC059948 |
| Gene Symbol | CSTF3 |
| Gene ID (NCBI) | 1479 |
| RRID | AB_2879475 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12996 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| IP protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| WB protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CSTF3 Polyclonal antibody (Cat# 24290-1-AP) has 3 citations published in Cell Death & Disease, Computational and Structural Biotechnology Journal, and iScience. The associated research fields include ovarian cancer platinum resistance via alternative polyadenylation, metabolic and inflammatory protein regulation in gestational diabetes mellitus, and spermatogonial self-renewal involving chromatin accessibility and mRNA stability.
| Species | Application | Title |
|---|---|---|
Cell Death Dis CSTF3 contributes to platinum resistance in ovarian cancer through alternative polyadenylation of lncRNA NEAT1 and generating the short isoform NEAT1_1 | ||
Comput Struct Biotechnol J Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus | ||
iScience Chromodomain helicase DNA-binding domain 2 maintains spermatogonial self-renewal by promoting chromatin accessibility and mRNA stability
|
Reviews
What customers say
The single review for this antibody reports a 4-star rating for Western Blot. The user found that the antibody works but produces a low signal on the tested cell lines, noting that further optimization was not attempted. The recommended dilution used was 1:500. Overall, the feedback suggests the product is functional but may require additional optimization to achieve stronger signal intensity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sarah (Verified Customer) (10-31-2025) | Antibody works but with low signal for tested cell lines, though further optimization was not tried.
|
