CSTF3 Polyclonal antibody

• 

  WB analysis using 24290-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24290-1-AP (CSTF3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 24290-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 24290-1-AP (CSTF3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 24290-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 24290-1-AP (CSTF3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 24290-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 24290-1-AP (CSTF3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 24290-1-AP

  IP result of anti-CSTF3 (IP:24290-1-AP, 4ug; Detection:24290-1-AP 1:500) with A431 cells lysate 1200ug.

• 

  IHC staining of human stomach cancer using 24290-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24290-1-AP (CSTF3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CSTF3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24290-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CF-1 77 kDa subunit, CSTF 77, CstF-77

---

Tested Applications

• Positive WB detected in: A431 cells, K-562 cells, HEK-293 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

24290-1-AP targets CSTF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17930

  Product name: Recombinant human CSTF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC059948

  Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN

• Full Name: cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
• Calculated Molecular Weight: 717 aa, 83 kDa
• Observed Molecular Weight: 77-83 kDa
• GenBank Accession Number: BC059948
• Gene Symbol: CSTF3
• Gene ID (NCBI): 1479
• RRID: AB_2879475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12996
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF,IP	iScience; Chromodomain helicase DNA-binding domain 2 maintains spermatogonial self-renewal by promoting chromatin accessibility and mRNA stability; Authors - Ziqian Min ; KD Validated
human	WB	Comput Struct Biotechnol J; Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus; Authors - Bingnan Chen
human	IF	Cell Death Dis; CSTF3 contributes to platinum resistance in ovarian cancer through alternative polyadenylation of lncRNA NEAT1 and generating the short isoform NEAT1_1; Authors - Xin Luo