CTAGE1 Polyclonal antibody

• 

  WB analysis using 13267-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13267-1-AP (CTAGE1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 13267-1-AP

  IP result of anti-CTAGE1 (IP:13267-1-AP, 4ug; Detection:13267-1-AP 1:500) with HeLa cells lysate 2400ug.

CTAGE1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 13267-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

Cancer/testis antigen 21.2, CT21.1, CT21.2, CT21.2,CTAGE2, CTAGE, CTAGE 1, CTAGE 2, CTAGE1, CTAGE2, Protein cTAGE 2

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13267-1-AP targets CTAGE1 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3948

  Product name: Recombinant human CTAGE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 466-780 aa of BC031065

  Sequence: DNWSAAWTAERNLNDLRKENAHNRQKLTEIEFKIKLLEKDPYGLDVPNTAFGRQHSPYGPSPLGWPSSETRASLYPPTLLEGPLRLSPLLPRGGGRGSRGPGNPPDHQITKERGESSCDRLTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNCARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLPAENEATGPGFVPPPLAPIRGLLFPVDTRGPFIRRGPPFPPPPPGTVFGASPDYFSPRDVPGPPRAPFAMRNVYLPRGFLPYRPPRPAFFPPAPTF

• Full Name: cutaneous T-cell lymphoma-associated antigen 1
• Calculated Molecular Weight: 754 aa, 89 kDa
• Observed Molecular Weight: 86-120 kDa
• GenBank Accession Number: BC031065
• Gene Symbol: CTAGE1
• Gene ID (NCBI): 64693
• RRID: AB_2086621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Res; A new type of ERGIC-ERES membrane contact mediated by TMED9 and SEC12 is required for autophagosome biogenesis.; Authors - Shulin Li
human	WB	Clin Cancer Res; Ectopic Expression of Cancer-Testis Antigens in Cutaneous T-cell Lymphoma Patients.; Authors - Ivan V Litvinov