Tested Applications
| Positive FC detected in | Con A treated mouse splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 0.1 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
APC-FcA98147 targets CTLA-4/CD152 in FC applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0632 Product name: Recombinant Mouse CTLA-4 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 36-162 aa of NM_009843.4 Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF Predict reactive species |
| Full Name | cytotoxic T-lymphocyte-associated protein 4 |
| Calculated Molecular Weight | 25 kDa |
| GenBank Accession Number | NM_009843.4 |
| Gene Symbol | CTLA-4 |
| Gene ID (NCBI) | 12477 |
| RRID | AB_3746558 |
| Conjugate | APC Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 650 nm / 660 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P09793 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CTLA-4, also known as CD152, belonging to the immunoglobulin superfamily, is primarily found on activated T cells and regulatory T cells (Tregs). CTLA-4 is closely related to the T-cell costimulatory CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells. CTLA-4 acts as a negative regulatory molecule of T-cell responses. Besides the full-length transmembrane form, CTLA-4 also exists in a truncated soluble form (sCTLA-4).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for APC CTLA-4/CD152 antibody APC-FcA98147 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



