CTNNAL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CTNNAL1 Polyclonal antibody, PBS Only (32926-1-PBS)

• 

  WB analysis using 32926-1-AP (same clone as 32926-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32926-1-AP (CTNNAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32926-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 32926-1-AP (same clone as 32926-1-PBS)

  WB result of CTNNAL1 antibody (32926-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CTNNAL1 transfected HepG2 cells. This data was developed using the same antibody clone with 32926-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CTNNAL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32926-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ACRP, Alpha catenin related protein, alpha CATU, Alpha catulin, Alpha-catenin-related protein

---

Product Information

32926-1-PBS targets CTNNAL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38629

  Product name: Recombinant human CTNNAL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-535 aa of NM_003798

  Sequence: ISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYG

• Full Name: catenin (cadherin-associated protein), alpha-like 1
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: NM_003798
• Gene Symbol: CTNNAL1
• Gene ID (NCBI): 8727
• RRID: AB_3742792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UBT7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Catenin alpha-like protein 1 (CTNNAL1, also known as alpha-catulin) is a cytoplasmic molecule that integrates the crosstalk between nuclear factor-kappa B (NF-κB) and Rho signaling pathways. It plays a crucial role in maintaining epithelial integrity and promoting wound repair in bronchial epithelial cells. CTNNAL1 has been shown to inhibit ozone-induced airway epithelial-mesenchymal transition and regulate mucus hypersecretion induced by house dust mite (HDM) (PMID: 38602002). Additionally, CTNNAL1 promotes the structural integrity of bronchial epithelial cells through the RhoA/ROCK1 pathway (PMID: 36535402). In cancer, CTNNAL1 regulates cancer stem cells (CSCs) in lung cancer and glioblastoma, modulating their migration and invasion abilities (PMID: 37239133).