CTP synthase Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86455-1-RR (same clone as 86455-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86455-1-RR (CTPS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86455-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86455-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86455-1-RR against Human CTP synthase were performed. The affinity constant is below 1 pM.

CTP synthase Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86455-1-PBS

Clone No.251260F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CTPS, CTPS 1, CTPS1, EC:6.3.4.2, UTP--ammonia ligase 1

---

Product Information

86455-1-PBS targets CTP synthase in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8707

  Product name: Recombinant human CTPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-591 aa of BC009408

  Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD

• Full Name: CTP synthase
• Calculated Molecular Weight: 591 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC009408
• Gene Symbol: CTPS
• Gene ID (NCBI): 1503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17812
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CTP synthase (CTPS) is a ubiquitous, cytosolic glutamine amidotransferase that catalyzes the ATP-dependent conversion of uridine-5′-triphosphate (UTP) to cytidine-5′-triphosphate (CTP) - the final, rate-limiting step in the de novo pyrimidine biosynthetic pathway.