CUEDC2 Polyclonal antibody

CUEDC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 20123-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

HOYS6, CUE domain-containing protein 2, CUE domain containing 2, C10orf66

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, mouse kidney tissue, HeLa cells, human brain tissue, human kidney tissue, Jurkat cells, mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman ovary tumor tissue, human breast cancer tissue, human malignant melanoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20123-1-AP targets CUEDC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13847

Product name: Recombinant human CUEDC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-226 aa of BC000262

Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA

Predict reactive species
Full Name CUE domain containing 2
Calculated Molecular Weight 287 aa, 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000262
Gene Symbol CUEDC2
Gene ID (NCBI) 79004
RRIDAB_10638318
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H467
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer.

Protocols

Product Specific Protocols
IF protocol for CUEDC2 antibody 20123-1-APDownload protocol
IHC protocol for CUEDC2 antibody 20123-1-APDownload protocol
IP protocol for CUEDC2 antibody 20123-1-APDownload protocol
WB protocol for CUEDC2 antibody 20123-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...