CoraLite® Plus 488-conjugated CUEDC2 Polyclonal antibody

CUEDC2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-20123

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

C10orf66, CUE domain containing 2, CUE domain-containing protein 2, HOYS6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20123 targets CUEDC2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13847

Product name: Recombinant human CUEDC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-226 aa of BC000262

Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA

Predict reactive species
Full Name CUE domain containing 2
Calculated Molecular Weight 287 aa, 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000262
Gene Symbol CUEDC2
Gene ID (NCBI) 79004
RRIDAB_3672712
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H467
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CUEDC2 antibody CL488-20123Download protocol
IF protocol for CL Plus 488 CUEDC2 antibody CL488-20123Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...