CUEDC2 Recombinant monoclonal antibody

• 

  WB analysis using 86610-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86610-2-RR (CUEDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86610-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86610-2-RR (CUEDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 86610-2-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86610-2-RR (CUEDC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 86610-2-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86610-2-RR (CUEDC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 86610-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86610-2-RR against Human CUEDC2 were performed. The affinity constant is 0.925 nM.

CUEDC2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86610-2-RR

Clone No.251583E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C10orf66, CUE domain containing 2, CUE domain-containing protein 2, HOYS6

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, HCT 116 cells, ACHN cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86610-2-RR targets CUEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13847

  Product name: Recombinant human CUEDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC000262

  Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA

• Full Name: CUE domain containing 2
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000262
• Gene Symbol: CUEDC2
• Gene ID (NCBI): 79004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H467
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer.