CUEDC2 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86610-2-RR (same clone as 86610-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86610-2-RR (CUEDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86610-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 86610-2-RR (same clone as 86610-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86610-2-RR (CUEDC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86610-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86610-2-RR (same clone as 86610-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86610-2-RR (CUEDC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86610-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86610-2-RR (same clone as 86610-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86610-2-RR (CUEDC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86610-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02553-1

  The mean CUEDC2 concentration was determined to be 51.3 ng/mL in HeLa cell extract based on a 1.1 mg/mL extract load, 49.9 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02553-1

  Cytometric bead array standard curve of MP02553-1, CUEDC2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86610-1-PBS. Detection antibody: 86610-2-PBS. Standard: Ag13847. Range: 0.625-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 86610-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86610-2-RR against Human CUEDC2 were performed. The affinity constant is 0.925 nM.

CUEDC2 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 86610-2-PBS

Clone No.251583E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

C10orf66, CUE domain containing 2, CUE domain-containing protein 2, HOYS6

---

Product Information

86610-2-PBS targets CUEDC2 as part of a matched antibody pair:

MP02553-1: 86610-1-PBS capture and 86610-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13847

  Product name: Recombinant human CUEDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC000262

  Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA

• Full Name: CUE domain containing 2
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000262
• Gene Symbol: CUEDC2
• Gene ID (NCBI): 79004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H467
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer.