CUGBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CUGBP1 Polyclonal antibody (13002-1-AP)

• Featured Product
• KD/KO Validated

CUGBP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13002-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CELF1, CELF 1, Bruno-like protein 2, BRUNOL2, Bruno like protein 2

• 

  WB analysis using 13002-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13002-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 13002-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13002-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 13002-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 13002-1-AP

  IP result of anti-CUGBP1 (IP:13002-1-AP, 4ug; Detection:13002-1-AP 1:500) with HeLa cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13002-1-AP (CUGBP1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 13002-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13002-1-AP (CUGBP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13002-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CUGBP1 antibody (13002-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CUGBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, NIH/3T3 cells, HT-1080 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human skin cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13002-1-AP targets CUGBP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3677

  Product name: Recombinant human CUGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-479 aa of BC031079

  Sequence: DRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKND

• Full Name: CUG triplet repeat, RNA binding protein 1
• Calculated Molecular Weight: 483 aa, 52 kDa
• Observed Molecular Weight: 51-55 kDa
• GenBank Accession Number: BC031079
• Gene Symbol: CUGBP1
• Gene ID (NCBI): 10658
• RRID: AB_10642947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92879
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CUG triplet repeat RNA binding protein 1 (CUGBP1) is a member of the CUGBP Elav-like family (CELF), which plays an important role in cardiac development and function (PMID: 17130239). CUGBP1 has also been shown to localize to cytoplasmic stress granules when cells are stressed.

Publications

What published studies show

The CUGBP1 Polyclonal antibody (Cat# 13002-1-AP) has 8 citations published in EMBO Reports, Scientific Reports, iScience, Carcinogenesis, Human Molecular Genetics, Genes (Basel), Life Science Alliance, and Bioengineered. Research fields span cardiac ischemia-reperfusion injury, cardiomyocyte hypertrophy, lung and breast cancer, pancreatic β-cell function, fragile X tremor ataxia syndrome, RNA-binding protein biology, and liver fibrosis. Applications cited include WB, IHC, IP, and CoIP across human, mouse, and rat species.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,CoIP	EMBO Rep; p16(INK4a) promotes myocardial ischemia-reperfusion injury by regulating bile acid transport via Slco1a4.; Authors - Tingting Yang
human	WB	Sci Rep; DLX6-AS1 activated by H3K4me1 enhanced secondary cisplatin resistance of lung squamous cell carcinoma through modulating miR-181a-5p/miR-382-5p/CELF1 axis.; Authors - Xu Zhao ; KD Validated
mouse	WB	iScience; Insulin receptor isoform B is required for efficient proinsulin processing in pancreatic β cells; Authors - Mingchao Jiang
human	WB	Carcinogenesis; RNA-binding protein CUGBP1 controls the differential INSR splicing in molecular subtypes of breast cancer cells and affects cell aggressiveness.; Authors - Gena Huang ; KD Validated
rat	WB	Genes (Basel); CELF1 Downregulation Promotes Cardiomyocyte Hypertrophy via Regulating Alternative Splicing of Tead1.; Authors - Lingjie Hu ; KD Validated
human,mouse,rat	IP	Life Sci Alliance; Endo-bind-n-seq: identifying RNA motifs of RNA binding proteins isolated from endogenous sources; Authors - Tiana Nicole Hanelt