CUL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CUL3 Polyclonal antibody, PBS Only (28087-1-PBS)

• 

  WB analysis using 28087-1-AP (same clone as 28087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28087-1-AP (CUL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28087-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28087-1-AP (same clone as 28087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28087-1-AP (CUL3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28087-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 28087-1-AP (same clone as 28087-1-PBS)

  IP result of anti-CUL3 (IP:28087-1-AP, 4ug; Detection:28087-1-AP 1:600) with mouse testis tissue lysate 1680 ug. This data was developed using the same antibody clone with 28087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 28087-1-AP (same clone as 28087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 28087-1-AP (CUL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 28087-1-AP (same clone as 28087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 28087-1-AP (CUL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28087-1-PBS in a different storage buffer formulation.

CUL3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 28087-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CUL-3, Cullin-3, KIAA0617

---

Product Information

28087-1-PBS targets CUL3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28004

  Product name: Recombinant human CUL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC039598

  Sequence: MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFE

• Full Name: cullin 3
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 80-88 kDa
• GenBank Accession Number: BC039598
• Gene Symbol: CUL3
• Gene ID (NCBI): 8452
• RRID: AB_2918147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13618
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ligase are the largest family of ubiquitin ligases which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. One of seven cullin proteins serves as a scaffold protein for the assembly of the multisubunit ubiquitin ligase complex. CUL3 (Cullin-3) ubiquitin ligase complex targets multiple substrate for ubiquitination including cyclin E and of cyclin D1. Defects in CUL3 are the cause of Pseudohypoaldosteronism type 2E (PHA2E) characterized by severe hypertension, hyperkalemia, hyperchloremia, hyperchloremic metabolic acidosis, and correction of physiologic abnormalities by thiazide diuretics.