CUL4A Monoclonal antibody, PBS Only

• 

  WB analysis using 66038-1-Ig (same clone as 66038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66038-1-Ig (CUL4A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66038-1-Ig (same clone as 66038-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66038-1-Ig (CUL4A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66038-1-Ig (same clone as 66038-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66038-1-Ig (CUL4A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 66038-1-Ig (same clone as 66038-1-PBS)

  IP result of anti-CUL4A (IP:66038-1-Ig, 4ug; Detection:66038-1-Ig 1:500) with MCF-7 cells lysate 2800ug. This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66038-1-Ig (CUL4A Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66038-1-Ig (CUL4A Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 66038-1-Ig(CUL4A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 66038-1-Ig(CUL4A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 66038-1-Ig(CUL4A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 66038-1-Ig(CUL4A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66038-1-Ig (same clone as 66038-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 66038-1-Ig (CUL4A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG (H+L). This data was developed using the same antibody clone with 66038-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CUL4A Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 66038-1-PBS

Clone No.1A7F12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, monkey

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

1A7F12, CUL 4A, CUL-4A, cullin 4A

---

Product Information

66038-1-PBS targets CUL4A in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, monkey samples.

• Tested Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18089

  Product name: Recombinant human CUL4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 460-759 aa of BC008308

  Sequence: RLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA

• Full Name: cullin 4A
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 77 kDa, 88 kDa
• GenBank Accession Number: BC008308
• Gene Symbol: CUL4A
• Gene ID (NCBI): 8451
• RRID: AB_11042446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13619
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cullin proteins assemble a large number of RING E3 ubiquitin ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Two cullin 4 (CUL4) proteins, CUL4A (87 kDa) and CUL4B(104 kDa), have been identified. The two CUL4 sequences are 83% identical. They target certain proteins for degradation by binding protein DDB1 to form a CUL4-DDB1 ubiquitin ligase complex with DDB. They form two individual E3 ligases, DDB1-CUL4ADDB2 and DDB1-CUL4BDDB2 in this process. CUL4A appeared in both the nucleus and the cytosol, suggesting a more complex mechanism for entering the nucleus. CUL4B is localized in the nucleus and facilitates the transfer of DDB1 into the nucleus independently of DDB2.