CUTA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CUTA Polyclonal antibody, PBS Only (15610-1-PBS)

• 

  WB analysis using 15610-1-AP (same clone as 15610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15610-1-AP (CUTA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15610-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 15610-1-AP (same clone as 15610-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CUTA antibody (15610-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15610-1-PBS in a different storage buffer formulation.

CUTA Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 15610-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Acetylcholinesterase-associated protein, ACHAP, C6orf82, Protein CutA

---

Product Information

15610-1-PBS targets CUTA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8000

  Product name: Recombinant human CUTA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC005890

  Sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

• Full Name: cutA divalent cation tolerance homolog (E. coli)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC005890
• Gene Symbol: CUTA
• Gene ID (NCBI): 51596
• RRID: AB_3669214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60888
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CUTA also known as ACHAP, functions in cellular copper sensitivity and in the processing and trafficking of membrane proteins. CUTA, the mammalian CutA divalent cation tolerance homolog (E. coli), has been proposed to mediate acetylcholinesterase activity and copper homeostasis. Human CUTA has several variants that differ in N-terminal length and are separated as heavy (H) and light (L) components. The H component of human CUTA was associated with the membrane fraction, whereas the L component of human CUTA was in the cytosol(PMID: 22351782).