CWF19L1 Polyclonal antibody

• 

  WB analysis using 31700-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31700-1-AP (CWF19L1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

CWF19L1 Polyclonal Antibody for WB, ELISA

Cat No. 31700-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

SCAR17, hDrn1, C19L1

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31700-1-AP targets CWF19L1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36356

  Product name: Recombinant human CWF19L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 325-538 aa of BC008746

  Sequence: PGPCWFCLASPEVEKHLVVNIGTHCYLALAKGGLSDDHVLILPIGHYQSVVELSAEVVEEVEKYKATLRRFFKSRGKWCVVFERNYKSHHLQLQVIPVPISCSTTDDIKDAFITQAQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDFTLDD

• Full Name: CWF19-like 1, cell cycle control (S. pombe)
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC008746
• Gene Symbol: CWF19L1
• Gene ID (NCBI): 55280
• RRID: AB_3670086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q69YN2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CWF19L1 belongs to the CWF19 family. CWF19L1 includes a metallophosphatase (MMP) domain, a histidine triad motif (HIT) domain, and a C-terminal Cwf-J-C domain. CWF19L1 is believed to be involved in cell cycle control, endosomal trafficking, and mRNA processing. CWF19L1 is a rare cause of autosomal recessive cerebellar ataxias (ARCA) (PMID: 36357319, PMID: 36453471). CWF19L1 is expressed in many brain regions, including cerebellum, thalamus and occipital, parietal and temporal lobes. CWF19L1 is also expressed in the spinal cord (PMID: 25361784).