CX3CL1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CX3CL1 Monoclonal antibody (60339-1-Ig)

CX3CL1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60339-1-Ig Copied!

Clone No. 2F5D5

Publications (5)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CX3C membrane-anchored chemokine, C3Xkine, C X3 C motif chemokine 1, ABCD 3, A-152E5.2

• 

  WB analysis of PC-3 using 60339-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 60339-1-Ig (CX3CL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 60339-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 60339-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 60339-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 60339-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CX3CL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells
• Positive IHC detected in: human brain tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60339-1-Ig targets CX3CL1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0161

  Product name: Recombinant human CX3CL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-245 aa of BC001163

  Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ

• Full Name: chemokine (C-X3-C motif) ligand 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC001163
• Gene Symbol: CX3CL1
• Gene ID (NCBI): 6376
• RRID: AB_2881448
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78423
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

60339-1-Ig is a CX3CR1 antibody with 5 total citations. Citations appear in Aging Cell, Frontiers in Immunology, Neuroscience Bulletin, JCI Insight, and Frontiers in Aging Neuroscience. Associated research fields include neurodegeneration and aging, macrophage polarization in Sjögren's syndrome, microglial function after ischemic injury, IgG4-related disease immunology, and Parkinson's disease neuroprotection.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Aging Cell; Single-Cell RNA-Seq Reveals Aging-Related Impairment of Microglial Efferocytosis Contributing to Apoptotic Cells Accumulation After Retinal Injury; Authors - Pan Liu
mouse	IHC	Front Immunol; Myeloid-derived growth factor promotes M2 macrophage polarization and attenuates Sjögren's syndrome via suppression of the CX3CL1/CX3CR1 axis; Authors - Zi Yang
mouse	WB,IF	Neurosci Bull; Multiple Mild Stimulations Reduce Membrane Distribution of CX3CR1 Promoted by Annexin a1 in Microglia to Attenuate Excessive Dendritic Spine Pruning and Cognitive Deficits Caused by a Transient Ischemic Attack in Mice; Authors - Lu Zheng
human	IF	JCI Insight; Single-cell transcriptome analysis and protein profiling reveal broad immune system activation in IgG4-related disease; Authors - Chenyang Lu
mouse	WB,IF	Front Aging Neurosci; Systems-level molecular and immunological evidence identifies Th17/Treg modulation as a key mechanism of CRSJ's neuroprotection in Parkinson's disease; Authors - Xun Li