CX3CL1 Monoclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 60339-1-Ig (same clone as 60339-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 60339-1-Ig (CX3CL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60339-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 60339-1-Ig (same clone as 60339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60339-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 60339-1-Ig (same clone as 60339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60339-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 60339-1-Ig (same clone as 60339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60339-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 60339-1-Ig (same clone as 60339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60339-1-Ig (CX3CL1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60339-1-PBS in a different storage buffer formulation.

CX3CL1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60339-1-PBS

Clone No.2F5D5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CX3C membrane-anchored chemokine, C3Xkine, C X3 C motif chemokine 1, ABCD 3, A-152E5.2

---

Product Information

60339-1-PBS targets CX3CL1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0161

  Product name: Recombinant human CX3CL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-245 aa of BC001163

  Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ

• Full Name: chemokine (C-X3-C motif) ligand 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC001163
• Gene Symbol: CX3CL1
• Gene ID (NCBI): 6376
• RRID: AB_2881448
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78423
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.