CXCL10/IP-10 Recombinant monoclonal antibody, PBS Only

CXCL10/IP-10 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 85307-1-PBS
Clone No.242013E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

CXCL10, CXCL10/IP10, IP10, 10 kDa interferon gamma-induced protein, C X C motif chemokine 10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85307-1-PBS targets CXCL10/IP-10 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2489

Product name: Recombinant Human CXCL10/IP-10 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-98 aa of BC010954

Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 10
Calculated Molecular Weight 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC010954
Gene Symbol CXCL10
Gene ID (NCBI) 3627
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02778
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.

Loading...
||
New chat

Able

正在加载,请稍候...