CXCL12/SDF-1 Recombinant monoclonal antibody

• 

  WB analysis using 87669-1-RR

  HEK-293T cells and mouse Cxcl12 transfected HEK-293T cells lysates were subjected to SDS PAGE followed by western blot with 87669-1-RR (CXCL12/SDF-1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 87669-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87669-1-RR (CXCL12/SDF-1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 87669-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87669-1-RR against Mouse CXCL12/SDF-1 were performed. The affinity constant is 4.03 nM.

CXCL12/SDF-1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87669-1-RR

Clone No.252850A8

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

Cxcl12, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, C-X-C motif chemokine 12, CXCL 12, hIRH

---

Tested Applications

• Positive WB detected in: Transfected with Mouse Cxcl12 HEK-293T cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

87669-1-RR targets CXCL12/SDF-1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2402

  Product name: recombinant mouse Cxcl12 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-89 aa of BC020297

  Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

• Full Name: chemokine (C-X-C motif) ligand 12
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC020297
• Gene Symbol: Cxcl12
• Gene ID (NCBI): 20315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	NPJ Regen Med; CD73 overexpression in ADSCs accelerates bladder repair by regulating the NFκB/NLRP3/caspase-1 signaling axis in neurogenic bladder rats.; Authors - Guanqun Zhu