CXCL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CXCL2 Polyclonal antibody (26791-1-AP)

CXCL2 Polyclonal Antibody for WB, ELISA

Cat No. 26791-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, Neutralization, ELISA

Synonyms

C X C motif chemokine 2, CINC 2a, CXCL2, Gro beta, GRO beta T, GRO2, GROb, Growth regulated protein beta, HSF, MGSA b, MIP 2a, MIP2, MIP2 alpha, MIP2A, SB 251353, SCYB2

• 

  WB analysis using 26791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26791-1-AP (CXCL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26791-1-AP

  human milk was subjected to SDS PAGE followed by western blot with 26791-1-AP (CXCL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, human milk, rat lung tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26791-1-AP targets CXCL2 in WB, IHC, IF, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25376

  Product name: Recombinant human CXCL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 35-107 aa of BC015753

  Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

• Full Name: chemokine (C-X-C motif) ligand 2
• Calculated Molecular Weight: 107 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC015753
• Gene Symbol: CXCL2
• Gene ID (NCBI): 2920
• RRID: AB_3085904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19875
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL2, also known as macrophage inflammatory protein 2-alpha (MIP2-alpha), is a member of CXC chemokine family that binds to CXC chemokine receptor 2 (CXCR2). CXCL2 is mainly produced by macrophages, endothelial cells, epithelial cells and tumor cells. CXCL2 plays important roles in various biological progresses such as angiogenesis, inflammation, immune response and cancer biological behaviors. Under inflammatory conditions in CNS, microglia and astrocytes may secrete CXCL2 as well as other chemokines, which induces chemotaxis and infiltration of circulatory neutrophils. Indeed, previous studies suggest that CXCL2 is involved in Alzheimer disease, multiple sclerosis and brain ischemia.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Cell; Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy; Authors - Chen Yang
human	WB	Immunity; Human immune aging clock identifies RUNX1 as a decelerator of T cell senescence.; Authors - Jiale Ping
rat	WB	Metabolism; USP48 protects against myocardial ischemia-reperfusion injury by stabilizing and upregulating CNN1 in type 1 diabetes mice; Authors - Jia-Bao Su
mouse	IF	Adv Sci (Weinh); Caspase-6/Gasdermin C-Mediated Tumor Cell Pyroptosis Promotes Colorectal Cancer Progression Through CXCL2-Dependent Recruitment of Myeloid-Derived Suppressor Cells; Authors - Hanchao Gao
human,mouse,rat	WB	Cell Rep Med; Trilaciclib triggers a neutrophil-related immune response and sensitizes non-small cell lung cancer to anti-PD-1 therapy.; Authors - Yuan Gao
mouse	IF	Acta Pharmacol Sin; A novel resveratrol analog upregulates sirtuin 1 and inhibits inflammatory cell infiltration in acute pancreatitis.; Authors - Zheng-Nan Ren