CXCL2 Polyclonal antibody

CXCL2 Polyclonal Antibody for WB, ELISA

Cat No. 26791-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, Neutralization, ELISA

C X C motif chemokine 2, CINC 2a, CXCL2, Gro beta, GRO beta T, GRO2, GROb, Growth regulated protein beta, HSF, MGSA b, MIP 2a, MIP2, MIP2 alpha, MIP2A, SB 251353, SCYB2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, human milk, rat lung tissue, mouse lung tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26791-1-AP targets CXCL2 in WB, IF, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25376

Product name: Recombinant human CXCL2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 35-107 aa of BC015753

Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 2
Calculated Molecular Weight 107 aa, 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC015753
Gene Symbol CXCL2
Gene ID (NCBI) 2920
RRIDAB_3085904
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19875
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL2, also known as macrophage inflammatory protein 2-alpha (MIP2-alpha), is a member of CXC chemokine family that binds to CXC chemokine receptor 2 (CXCR2). CXCL2 is mainly produced by macrophages, endothelial cells, epithelial cells and tumor cells. CXCL2 plays important roles in various biological progresses such as angiogenesis, inflammation, immune response and cancer biological behaviors. Under inflammatory conditions in CNS, microglia and astrocytes may secrete CXCL2 as well as other chemokines, which induces chemotaxis and infiltration of circulatory neutrophils. Indeed, previous studies suggest that CXCL2 is involved in Alzheimer disease, multiple sclerosis and brain ischemia.

Protocols

Product Specific Protocols
WB protocol for CXCL2 antibody 26791-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cancer Cell

Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy

Authors - Chen Yang
mouseIF

Acta Pharmacol Sin

A novel resveratrol analog upregulates sirtuin 1 and inhibits inflammatory cell infiltration in acute pancreatitis.

Authors - Zheng-Nan Ren
mouseIF

Int J Mol Sci

MyD88 in Macrophages Enhances Liver Fibrosis by Activation of NLRP3 Inflammasome in HSCs.

Authors - Shuang Ge
mouseWB

J Immunol

Macrophagic Extracellular Vesicle CXCL2 Recruits and Activates the Neutrophil CXCR2/PKC/NOX4 Axis in Sepsis.

Authors - Guozhen Wang
mouseWB

Int Immunopharmacol

Isoliquiritigenin alleviates LPS/ D-GalN-induced acute liver failure by activating the PGC-1α/ Nrf2 pathway to reduce oxidative stress and inflammatory response.

Authors - Lu Wang
humanWB

Biochem Genet

Characterizing Chemokine Signaling Pathways and Hub Genes in Calcium Oxalate-Induced Kidney Stone Formation: Insights from Rodent Models

Authors - Boqiang Wang
Loading...
||
New chat

Able

正在加载,请稍候...