Tested Applications
Positive FC (Intra) detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
FITC-98259 targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species |
Full Name | chemokine (C-X-C motif) ligand 2 |
Calculated Molecular Weight | 11 kDa |
GenBank Accession Number | NM_009140 |
Gene Symbol | Cxcl2 |
Gene ID (NCBI) | 20310 |
Conjugate | FITC Plus Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 495 nm / 524 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P10889 |
Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays an critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).
Protocols
Product Specific Protocols | |
---|---|
FC protocol for FITC Plus CXCL2 antibody FITC-98259 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |