CoraLite®594 Anti-Mouse CXCL2 Rabbit Recombinant Antibody

CXCL2 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL594-98259
Clone No.242007G5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98259 targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2239

Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 28-100 aa of NM_009140

Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 2
Calculated Molecular Weight11 kDa
GenBank Accession NumberNM_009140
Gene Symbol Cxcl2
Gene ID (NCBI) 20310
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10889
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays an critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).

Protocols

Product Specific Protocols
FC protocol for CL594 CXCL2 antibody CL594-98259Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...