CXCL4/PF4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse serum using 85647-1-RR (same clone as 85647-1-PBS)

  mouse serum was subjected to SDS PAGE followed by western blot with 85647-1-RR (CXCL4/PF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85647-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood platelets using 85647-1-RR (same clone as 85647-1-PBS)

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 85647-1-RR (CXCL4/PF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85647-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85647-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84647-1-RR against Human CXCL4/PF4 were performed. The affinity constant is 0.625 nM.

CXCL4/PF4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85647-1-PBS

Clone No.243087F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4

---

Product Information

85647-1-PBS targets CXCL4/PF4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2129

  Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-101 aa of NM_002619.4

  Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

• Full Name: platelet factor 4
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_002619.4
• Gene Symbol: PF4
• Gene ID (NCBI): 5196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02776
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation