Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody, PBS Only (98497-3-PBS)

Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody, PBS Only

Name: Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98497-3-PBS-1MG

CXCL7/PPBP Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98497-3-PBS

Clone No.250049B8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

Chemokine (C-X-C motif) ligand 7, Cxcl7, Ppbp

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of Transfected HEK-293T using 98497-3-RR (same clone as 98497-3-PBS)
1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98497-3-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98497-3-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98497-3-RR (same clone as 98497-3-PBS)
1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98497-3-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98497-3-PBS in a different storage buffer formulation.

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98497-3-PBS targets CXCL7/PPBP in FC (Intra) applications and shows reactivity with rat samples.

Tested Reactivity	rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3405 Product name: Recombinant Rat CXCL7/PPBP protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 46-107 aa of NM_153721.1 Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI Predict reactive species
Full Name	pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Calculated Molecular Weight	12 kDa
GenBank Accession Number	NM_153721.1
Gene Symbol	Ppbp
Gene ID (NCBI)	246358
RRID	AB_3746127
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q99ME0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.