Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat CXCL7/PPBP Rabbit Recombinant Antibody (98497-3-RR)

CXCL7/PPBP Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98497-3-RR

Clone No.250049B8

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

Chemokine (C-X-C motif) ligand 7, Cxcl7, Ppbp

• 

  FC experiment of Transfected HEK-293T using 98497-3-RR

  1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98497-3-RR

  1x10^6 HEK-293T cells or CXCL7/PPBP transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat CXCL7/PPBP Rabbit RecAb (98497-3-RR, Clone: 250049B8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98497-3-RR targets CXCL7/PPBP in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3405

  Product name: Recombinant Rat CXCL7/PPBP protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 46-107 aa of NM_153721.1

  Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

• Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: NM_153721.1
• Gene Symbol: Ppbp
• Gene ID (NCBI): 246358
• RRID: AB_3746127
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99ME0
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

PPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.