CoraLite® Plus 647 Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 647 Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody (CL647-98137)

CXCL8/IL-8 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. CL647-98137

Clone No.240889B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CXCL8, IL8, IL-8, 240889B2, C X C motif chemokine 8

• 

  FC experiment of human PBMCs using CL647-98137

  1x10^6 untreated or IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CXCL8/IL-8 Rabbit RecAb (CL647-98137, Clone: 240889B2). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL647-98137

  1x10^6 IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CXCL8/IL-8 Rabbit RecAb (CL647-98137, Clone: 240889B2) (red) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9) (blue). 1x10^6 untreated human PBMCs were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CXCL8/IL-8 Rabbit RecAb (CL647-98137, Clone: 240889B2) (black, dashed). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98137 targets CXCL8/IL-8 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0152

  Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 28-99 aa of BC013615

  Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

• Full Name: interleukin 8
• Calculated Molecular Weight: 99 aa, 11 kDa
• GenBank Accession Number: BC013615
• Gene Symbol: IL-8
• Gene ID (NCBI): 3576
• ENSEMBL Gene ID: ENSG00000169429
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10145
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression.