Anti-Human CXCL9/MIG Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98211-1-RR

  1x10^6 untreated or IFN gamma, TNF α and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL9/MIG Rabbit Recombinant Antibody (98211-1-RR, Clone: 241437F5) and PE-Conjugated Goat Anti-Rabbit IgG. Cells were co-stained with CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of human PBMCs using 98211-1-RR

  1x10^6 IFN gamma, TNF α and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL9/MIG Rabbit Recombinant Antibody (98211-1-RR, Clone: 241437F5) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL9/MIG Rabbit Recombinant Antibody (98211-1-RR, Clone: 241437F5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CXCL9/MIG Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98211-1-RR

Clone No.241437F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CXCL9, MIG, MIG; CXCL9, 241437F5, CMK

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, TNF α and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98211-1-RR targets CXCL9/MIG in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17932

  Product name: Recombinant human CXCL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-125 aa of BC095396

  Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

• Full Name: chemokine (C-X-C motif) ligand 9
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: BC095396
• Gene Symbol: CXCL9
• Gene ID (NCBI): 4283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q07325
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells.