CXCR3 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CXCR3 Recombinant monoclonal antibody, PBS Only (Detector) (84655-1-PBS)

CXCR3 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84655-1-PBS

Clone No.241790A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

CD182, CD183, CKR L2, CKR-L2, CMKAR3

• 

  Sandwich ELISA sample test of MP01488-2

  The mean CXCR3 concentration was determined to be 15.15 ng/mL in HeLa cell extract based on a 1.5 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP01488-2

  Sandwich ELISA standard curve of MP01488-2, Human CXCR3 Recombinant Matched Antibody Pair - PBS only. 84655-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2269. 84655-1-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP01488-2

  Cytometric bead array standard curve of MP01488-2, CXCR3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84655-2-PBS. Detection antibody: 84655-1-PBS. Standard: Eg2269. Range: 0.313-40 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84655-1-PBS targets CXCR3 as part of a matched antibody pair:

MP01488-2: 84655-2-PBS capture and 84655-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2269

  Product name: Recombinant Human CXCR3 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-53 aa of BC034403

  Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

• Full Name: chemokine (C-X-C motif) receptor 3
• Calculated Molecular Weight: 368 aa, 41 kDa
• GenBank Accession Number: BC034403
• Gene Symbol: CXCR3
• Gene ID (NCBI): 2833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49682
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.