CXCR5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CXCR5 Polyclonal antibody, PBS Only (28239-1-PBS)

• 

  WB analysis using 28239-1-AP (same clone as 28239-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28239-1-AP (CXCR5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28239-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 28239-1-AP (same clone as 28239-1-PBS)

  WB result of CXCR5 antibody (28239-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CXCR5 transfected Jurkat cells. This data was developed using the same antibody clone with 28239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28239-1-AP (same clone as 28239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28239-1-AP (CXCR5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28239-1-PBS in a different storage buffer formulation.

CXCR5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28239-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

MDR 15, CXCR 5, CXC R5, CD185, Burkitt lymphoma receptor 1

---

Product Information

28239-1-PBS targets CXCR5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28271

  Product name: Recombinant human CXCR5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 241-372 aa of NM_001716

  Sequence: MVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF

• Full Name: chemokine (C-X-C motif) receptor 5
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_001716
• Gene Symbol: CXCR5
• Gene ID (NCBI): 643
• RRID: AB_3086040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32302
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Initially discovered in 1992 as Burkitt's lymphoma receptor 1, CXCR5 (chemokine receptor 5, also known as CD185) is a seven-transmembrane G protein-coupled receptor (GPCR) protein (PMID: 32994482). CXCR5 is essential for naïve B-cell migration to and maturation in the lymph nodes and spleen, as well as for cluster of differentiation 4 T-cell (TFH and TCM) homing and interaction with B cells (PMID: 21471443). Moreover, CXCR5 is involved in the regulation of neural stem cells (NSC) and neuronal regeneration in the mouse brain, neuronal differentiation, neurogenesis, gliogenesis, and synaptogenesis (PMID: 37460877).