CXorf15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CXorf15 Polyclonal antibody, PBS Only (22357-1-PBS)

• 

  WB analysis using 22357-1-AP (same clone as 22357-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22357-1-AP (CXorf15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 22357-1-AP (same clone as 22357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 22357-1-AP (CXorf15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 22357-1-AP (same clone as 22357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 22357-1-AP (CXorf15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 22357-1-AP (same clone as 22357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 22357-1-AP (CXorf15 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22357-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 22357-1-AP (same clone as 22357-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 22357-1-AP (CXorf15 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22357-1-PBS in a different storage buffer formulation.

CXorf15 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22357-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ELRG, Environmental lipopolysaccharide-responding gene protein, Factor inhibiting ATF4-mediated transcription, FIAT, Gamma taxilin

---

Product Information

22357-1-PBS targets CXorf15 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17936

  Product name: Recombinant human CXorf15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 447-528 aa of BC101576

  Sequence: ELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIESVD

• Full Name: chromosome X open reading frame 15
• Calculated Molecular Weight: 528 aa, 61 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC101576
• Gene Symbol: CXorf15
• Gene ID (NCBI): 55787
• RRID: AB_2879087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NUQ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.