CYB5R1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CYB5R1 Polyclonal antibody, PBS Only (11807-1-PBS)

• 

  WB analysis of human placenta using 11807-1-AP (same clone as 11807-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11807-1-AP (CYB5R1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 11807-1-AP (same clone as 11807-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11807-1-AP (CYB5R1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11807-1-AP (same clone as 11807-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11807-1-AP (CYB5R1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human placenta using 11807-1-AP (same clone as 11807-1-PBS)

  IP result of anti-CYB5R1 (IP:11807-1-AP, 4ug; Detection:11807-1-AP 1:1000) with human placenta tissue lysate 1520ug. This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11807-1-AP (same clone as 11807-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11807-1-AP (CYB5R1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 11807-1-AP (same clone as 11807-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using CYB5R1 antibody (11807-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11807-1-PBS in a different storage buffer formulation.

CYB5R1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11807-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

b5R.1, cytochrome b5 reductase 1, EC:1.6.2.2, Humb5R2, NADH cytochrome b5 reductase 1

---

Product Information

11807-1-PBS targets CYB5R1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2475

  Product name: Recombinant human CYB5R1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-305 aa of BC018732

  Sequence: MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

• Full Name: cytochrome b5 reductase 1
• Calculated Molecular Weight: 305 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC018732
• Gene Symbol: CYB5R1
• Gene ID (NCBI): 51706
• RRID: AB_2089968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHQ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.