CYBRD1 Polyclonal antibody

• 

  WB analysis of COLO 320 using 26735-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 26735-1-AP (CYBRD1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 26735-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26735-1-AP (CYBRD1 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 26735-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26735-1-AP (CYBRD1 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 26735-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26735-1-AP (CYBRD1 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 26735-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26735-1-AP (CYBRD1 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CYBRD1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26735-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, ELISA

Synonyms

Cytochrome b reductase 1, DCYTB, Duodenal cytochrome b, EC:7.2.1.3, Ferric chelate reductase 3

---

Tested Applications

• Positive WB detected in: COLO 320 cells
• Positive IHC detected in: human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

26735-1-AP targets CYBRD1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24968

  Product name: Recombinant human CYBRD1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 148-286 aa of BC065290

  Sequence: PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM

• Full Name: cytochrome b reductase 1
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC065290
• Gene Symbol: CYBRD1
• Gene ID (NCBI): 79901
• RRID: AB_2880618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53TN4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Metallomics; Tolerable upper intake level of iron damages the intestine and alters the intestinal flora in weaned piglets.; Authors - Haoxuan Ding
mouse	WB	Biol Trace Elem Res; Chronic Psychological Stress Disrupts Iron Metabolism and Enhances Hepatic Mitochondrial Function in Mice.; Authors - Shihui Guo
human	WB,IHC	PeerJ; Identification of potential genes in upper tract urothelial carcinoma using next-generation sequencing with bioinformatics and in vitro analyses.; Authors - Hsiang-Ying Lee