CYC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CYC1 Polyclonal antibody, PBS Only (10242-1-PBS)

• 

  WB analysis of human brain using 10242-1-AP (same clone as 10242-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10242-1-AP (CYC1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10242-1-AP (same clone as 10242-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10242-1-AP (CYC1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10242-1-AP (same clone as 10242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10242-1-AP (CYC1 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10242-1-AP (same clone as 10242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10242-1-AP (CYC1 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10242-1-AP (same clone as 10242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10242-1-AP (CYC1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10242-1-AP (same clone as 10242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10242-1-AP (CYC1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10242-1-AP (same clone as 10242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10242-1-AP (CYC1 antibody) at dilution of 1:50 (under 25x lens). This data was developed using the same antibody clone with 10242-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CYC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10242-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10242-1-PBS targets CYC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0291

  Product name: Recombinant human CYC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-271 aa of BC001006

  Sequence: ALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVC

• Full Name: cytochrome c-1
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC001006
• Gene Symbol: CYC1
• Gene ID (NCBI): 1537
• RRID: AB_2090144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08574
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYC1, also named as Cytochrome c-1, belongs to the cytochrome c family. Cytochrome c1 is one respiratory subunit of the 11 subunits of the cytochrome bc1 complex of the mitochondrial electron-transfer chain. It mediates the transfer of an electron from Rieske iron-sulfur protein to cytochrome c(PMID:3036122 ). CYC1 mediates apoptosis. In this pathway, a variety of apoptotic stimuli cause CYC1 release from mitochondria, which in turn induces a series of biochemical reactions that result incaspase activation and subsequent cell death.(PMID:15189137) While CYC1 release and DNA fragmentation are unaffected by the noncleavablep75 mutant, mitochondrial morphology of dying cells is maintained, and loss of plasma membrane integrity is delayed(PMID:15186778). The protein migrated as a 35 kd band in SDS page.