CYFIP1/2 Polyclonal antibody

CYFIP1/2 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 16011-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), IP, ELISA

CYFIP2, PIR121, p53-inducible protein 121, p53 inducible protein 121, KIAA1168

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, human gliomas tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16011-1-AP targets CYFIP1/2 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8749

Product name: Recombinant human CYFIP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 855-1253 aa of BC011762

Sequence: CYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC

Predict reactive species
Full Name cytoplasmic FMR1 interacting protein 2
Calculated Molecular Weight 148 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC011762
Gene Symbol CYFIP2
Gene ID (NCBI) 26999
RRIDAB_2090638
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96F07
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYFIP1/2 belongs to the CYFIP family and is involved in T-cell adhesion and p53-dependent induction of apoptosis. CYFIP1 contains 1,253 amino acids and shares 88% sequence identity with CYFIP2. CYFIP1 and CYFIP2 are members of a highly conserved protein family and share approximately 99% sequence identity with their mouse orthologs. CYFIP1 has been shown to interact with the small GTPase RAC1, which is implicated in development and maintenance of neuronal structures. Consistent with FMRP and RAC1 localization in dendritic fine structures, CYFIP1/2 are present in synaptosomal extracts. This antibody can recognize both CYFIP1 and CYFIP2.

Protocols

Product Specific Protocols
WB protocol for CYFIP1/2 antibody 16011-1-APDownload protocol
IHC protocol for CYFIP1/2 antibody 16011-1-APDownload protocol
IP protocol for CYFIP1/2 antibody 16011-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Dis Markers

Two potential biomarkers identified in mesenchymal stem cells and leukocytes of patients with sporadic amyotrophic lateral sclerosis.

Authors - Nachmany Henny H
humanWB

Nat Commun

Phenylalanine-tRNA aminoacylation is compromised by ALS/FTD-associated C9orf72 C4G2 repeat RNA

Authors - Mirjana Malnar Črnigoj
mouseWB,IHC

Sci Rep

Construction of a diagnostic model utilizing m7G regulatory factors for the characterization of diabetic nephropathy and the immune microenvironment

Authors - Jingying Zhong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Bourcier (Verified Customer) (09-23-2024)

good antibodies

  • Applications: Immunoprecipitation
  • Cell Tissue Type: Fibroblastes
FH

Lisa (Verified Customer) (03-17-2022)

The antibody works well for WB. Dilution 1:1000 in TBS-T 5% BSA.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Neuronal cells
Loading...
||
New chat Able
正在加载,请稍候...