CYP17A1 Recombinant monoclonal antibody, PBS Only

CYP17A1 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85690-5-PBS
Clone No.243076D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

17-alpha-hydroxyprogesterone aldolase, CPT7, CYP17, CYPXVII, Cytochrome P450 17A1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85690-5-PBS targets CYP17A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5899

Product name: Recombinant human CYP17A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-508 aa of BC062997

Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST

Predict reactive species
Full Name cytochrome P450, family 17, subfamily A, polypeptide 1
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 50-57 kDa
GenBank Accession NumberBC062997
Gene Symbol CYP17A1
Gene ID (NCBI) 1586
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05093
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042).

Loading...
||
New chat Able
正在加载,请稍候...